Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human IL-23 protein

SKU: orb594820
ActiveBiologically Active

Description

This Human IL-23 protein spans the amino acid sequence from region 20-189aa & 23-328aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

Application Notes
Heterodimer

Key Properties

SourceMammalian cell
Biological OriginHomo sapiens (Human)
Biological ActivityThe ED50 as determined by its ability to induce STAT reporter activity in 293F human embryonic kidney cells is 70-210 ng/ml.
TagC-terminal 6xHis-tagged
Expression Region20-189aa&23-328aa
Protein LengthHeterodimer
EndotoxinsLess than 1.0 EU/μg as determined by LAL method.
MW54.4 kDa
PurityGreater than 95% as determined by SDS-PAGE.
Protein SequenceRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIW STDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

SGRF;IL-23p19;CLMF p40;IL-12 subunit p40;NKSF2

Similar Products

  • IL23R Antibody [orb47095]

    ELISA,  IF,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Recombinant Mouse IL-23R Protein [orb2994400]

    Unconjugated

    SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.

    Predicted: 67.4 KDa. Observed: 90-110 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Human IL-23R Protein [orb2994303]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 38.7 KDa. Observed: 50-90 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Human IL-23R Protein [orb2994313]

    Unconjugated

    SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.

    Predicted: 65 KDa. Observed: 90-120 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
  • Recombinant Human IL-23 Protein [orb2994028]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 55.2 KDa. Observed: 60-90 KDa, reducing conditions

    10 μg, 50 μg, 500 μg, 1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Human IL-23 protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Human IL-23 protein (orb594820)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 350.00
50 μg
$ 930.00
500 μg
$ 3,140.00
1 mg
$ 4,870.00
Instock
In stock
Bulk Enquiry