Human IL 13 Protein

SKU: orb429400

Description

Recombinant of human IL13 protein

Images & Validation

• Application Notes:
  Protein content: Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 0.57 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a calibrated solution of IL-13 as a Reference Standard

Key Properties

• Source: Escherichia Coli
• Biological Activity: The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be 1 x 106units/mg.
• Protein Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
• Purity: Greater than 95% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Storage & Handling

• Storage: Stability: Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Buffer/Preservatives: The protein (1mg/ml) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.