Human IL13 protein (Active)

SKU: orb358978

Description

This Human IL13 protein (Active) spans the amino acid sequence from region 35-146aa(R144Q). Purity: > 97% as determined by SDS-PAGE and HPLC.

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: E.Coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of ＞ 2.0 × 106 IU/mg.
• Tag: Tag-Free
• Molecular Weight: 12.3 kDa
• Expression Region: 35-146aa(R144Q)
• Protein Length: Partial
• Protein Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.2, with 5 % trehalose
• Disclaimer: For research use only

Alternative Names

Allergic rhinitis protein, ALRH protein, BHR 1 protein, BHR-1 protein, BHR1 protein, IL 13 protein, IL-13 protein, IL13 protein, Interleukin 13 protein, Interleukin-13 protein, Interleukin13 protein, NC30 protein, P600 protein

Quick Database Links

UniProt

P35225