You have no items in your shopping cart.
Human IL-13 protein
SKU: orb1215950
Description
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Human |
| Target | IL-13 |
| Molecular Weight | 12.3 kDa |
| Protein Length | 112.0 |
| Protein Sequence | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112) |
| Purity | 98% |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Human IL13 protein (Active) [orb358978]
> 97% as determined by SDS-PAGE and HPLC.
12.3 kDa
E.Coli
10 μg, 100 μg, 500 μgHuman IL13 protein (Active) [orb358979]
> 97% as determined by SDS-PAGE and HPLC.
12.5 kDa
E.Coli
10 μg, 100 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
IL-13
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human IL-13 protein (orb1215950)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review










