You have no items in your shopping cart.
Cart summary
Human IL-13 protein
Catalog Number: orb1215950
| Catalog Number | orb1215950 |
|---|---|
| Category | Proteins |
| Description | The Human IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-13 Specifications: (Molecular Weight: 12.3 kDa) (Amino Acid Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112)) (Gene ID: 3596). |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| MW | 12.3 kDa |
| Target | IL-13 |
| Protein Sequence | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112) |
| Protein Length | 112 |
| Source | Yeast |
| Biological Origin | Human |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 6
- Item 1 of 2
- Item 1 of 2
- Item 1 of 1
Human IL13 protein (Active) [orb358978]
> 97% as determined by SDS-PAGE and HPLC.
12.3 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
Human IL13 protein (Active) [orb358979]
> 97% as determined by SDS-PAGE and HPLC.
12.5 kDa
E.Coli
500 μg, 10 μg, 100 μg
