Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human IL-13 protein

SKU: orb1215950

Description

The Human IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-13 Specifications: (Molecular Weight: 12.3 kDa) (Amino Acid Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112)) (Gene ID: 3596).

Research Area

Immunology & Inflammation

Images & Validation

Key Properties

SourceYeast
Biological OriginHuman
TargetIL-13
Protein Length112.0
MW12.3 kDa
Purity98%
Protein SequenceGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Human IL-13 R alpha 2 Protein, His Tag [orb612134]

    Unconjugated

    90%

    39.0 kDa

    100 μg, 1 mg
  • Recombinant Mouse IL-13RA2 Protein [orb2992724]

    SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE. (QC verified)

    Predicted: 63.4 KDa. Observed: 70-110 KDa, reducing conditions

    1 mg, 500 μg, 50 μg, 10 μg
  • Recombinant Human IL-13RA1 Protein [orb2994201]

    Unconjugated

    SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.

    Predicted: 37.7 KDa. Observed: 55-65 KDa, reducing conditions

    500 μg, 1 mg, 10 μg, 50 μg
  • Human IL13 protein (Active) [orb358978]

    > 97% as determined by SDS-PAGE and HPLC.

    12.3 kDa

    E.Coli

    10 μg, 100 μg, 500 μg
  • Human IL13 protein (Active) [orb358979]

    > 97% as determined by SDS-PAGE and HPLC.

    12.5 kDa

    E.Coli

    10 μg, 100 μg, 500 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Human IL-13 protein (orb1215950)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
100 μg
$ 1,340.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry