You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IFN gamma protein
Catalog Number: orb594774
| Catalog Number | orb594774 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interferon gamma(IFNG) (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20mM Tris-HCl, 250mM NaCl, pH 8.5. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P01579 |
| MW | 16.88 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by a cytotoxicity assay using HT-29 cells is 17 pg/ml. |
| Expression Region | 24-166aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Interferon Gamma; IFN-Gamma; Immune Interferon; IF Read more... |
| Background | IFNγ is the major interferon produced by mitogenic Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human IFN gamma protein (Active) [orb359214]
> 98% as determined by SDS-PAGE and HPLC.
16.9 kDa
E.Coli
500 μg, 100 μg - Item 1 of 2
- Item 1 of 2
- Item 1 of 2
