You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human HBEGF protein
Catalog Number: orb605524
| Catalog Number | orb605524 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Proheparin-binding EGF-like growth factor(HBEGF),partial |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL |
| Protein Length | Partial |
| UniProt ID | Q99075 |
| MW | 11.7 kDa |
| Application notes | Partial |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 63-148aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Diphtheria toxin receptor Short name, DT-R DTR, DT Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human HBEGF protein (Active) [orb359173]
> 97% as determined by SDS-PAGE and HPLC.
9.7 kDa
E.Coli
10 μg, 500 μg, 100 μg - Item 1 of 1
Mouse HBEGF (24-160) Protein, hFc Tag [orb1173689]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 41.3 kDa after removal of the signal peptide.The apparent molecular mass of mHBEGF(24-160)-hFc is approximately 40-55 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg - Item 1 of 1
Human HBEGF Protein, hFc Tag [orb1173779]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 41.9 kDa after removal of the signal peptide. The apparent molecular mass of HBEGF-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg 
Human HBEGF protein [orb706952]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
50 μg, 500 μg, 10 μgRecombinant Human HBEGF Protein, N-His [orb2834966]
> 90% as determined by SDS-PAGE.
17.95 kDa
100 μg, 50 μg, 20 μg
