Human GLP2 protein

Catalog Number: orb604114

Catalog Number	orb604114
Category	Proteins
Description	Recombinant Human Glucagon(GCG),partial
Tag	N-terminal 6xHis-GST-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 85% as determined by SDS-PAGE.
MW	34.4 kDa
UniProt ID	P01275
Protein Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Protein Length	Partial
Source	E.coli
Expression System	Expression Region: 53-89aa. Protein Length: Partial
Expression Region	53-89aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Incretin hormone Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	30.4 kDa
Source:	E.coli

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human GCG(Arg21-Lys180) was fused with the C-terminal His Tag and expressed in Mammalian cells.