You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human FGF10 protein
Catalog Number: orb244206
| Catalog Number | orb244206 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Fibroblast growth factor 10 |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | O15520 |
| MW | 46.3 kDa |
| Application notes | This is His-SUMO-tag protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 38-208aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | FGF10 |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human FGF10 protein (Active) [orb359155]
> 97% as determined by SDS-PAGE and HPLC.
19.1 kDa
E.Coli
5 μg, 100 μg, 500 μg - Item 1 of 1
Recombinant human FGF10 protein [orb1516459]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 25 kDa based on Tris-Bis PAGE result.
100 μg 
Human FGF10 protein [orb706937]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μg- Item 1 of 1
Human FGF10 protein [orb82610]
HPLC, SDS-PAGE
Unconjugated
> 96% pure by SDS-PAGE and HPLC analyses.
19.3 kDa
500 μg, 5 μg, 100 μg Recombinant Human FGF10 Protein, N-His [orb2833228]
> 90% as determined by SDS-PAGE.
19.06 kDa
100 μg, 50 μg, 20 μg
