You have no items in your shopping cart.
Cart summary
Human FCGR3B Protein
Catalog Number: orb1477821
| Catalog Number | orb1477821 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B(FCGR3B),partial |
| Tag | N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 47.5 kDa |
| UniProt ID | O75015 |
| Protein Sequence | MRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIH |
| Protein Length | Partial |
| Source | E.coli |
| Expression System | Expression Region: 18-125aa. Protein Length: Partial |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | (Fc-gamma RIII-beta)(CD16-I)(Fc-gamma RIII)(Fc-gam Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
Human FCGR3B protein [orb391715]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman FCGR3B Protein, His Tag [orb1743278]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 21.6 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μgHuman FCGR3B Protein, hFc Tag [orb1743281]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 46.9 kDa after removal of the signal peptide. The apparent molecular mass of FCGR3B-hFc is approximately 55-100 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgRecombinant Human CD16B/FCGR3B Protein, His Tag [orb1553451]
≥90% as determined by SDS-PAGE
This protein contains the human FCGR3B(Met1-Ser200) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μgRecombinant Human FCGR3B Protein, His & Fc Tag [orb1552430]
≥90% as determined by SDS-PAGE
This protein contains the human FCGR3B(Thr20-Gln208) was fused with the C-terminal His-Fc Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars