You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human EPOR Protein
Catalog Number: orb1477883
| Catalog Number | orb1477883 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Erythropoietin receptor(EPOR),partial |
| Tag | C-terminal 10xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP |
| Protein Length | Partial |
| UniProt ID | P19235 |
| MW | 27.6 kDa |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Endotoxins | Not test. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 25-250aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | (EPO-R) |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Recombinant human EPOR protein, C-His (HEK293) [orb1808144]
> 90% as determined by SDS-PAGE
25.9 kDa
500 μg, 100 μg 
Recombinant Human EPOR Protein, N-His [orb2836264]
> 90% as determined by SDS-PAGE.
27.13 kDa
100 μg, 50 μg, 20 μgHuman EPOR Protein, His Tag [orb2701310]
> 98%, determined by SDS-PAGE
This protein contains the extracellular domain (Met 1-Pro 250) of human erythropoietin receptor (NP_000112.1) precursor was fused with a polyhistidine tag at the C-terminus and expressed from HEK293 Cells.
100 μg, 50 μgHuman EPOR Protein, Fc Tag [orb2701311]
> 90%, determined by SDS-PAGE
This protein contains (Met-Pro 250) of human erythropoietin receptor (NP_0001121) precursor was expressed with the C-terminal fused Fc region of human IgG1 and expressed from HEK293 Cells.
100 μg, 50 μg
