Human EGF protein

SKU: orb594725

Description

This Human EGF protein spans the amino acid sequence from region 971-1023aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Cancer Biology

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 60-450 pg/ml.
• Tag: Tag-Free
• Expression Region: 971-1023aa
• Protein Length: Partial
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.
• MW: 6.2 kDa
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 200 mM NaCl, pH 8.0
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Pro-Epidermal Growth Factor; EGF; Epidermal Growth Factor; Urogastrone

Quick Database Links

UniProt

P01133