You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human DKK1 at 2 μg/mL can bind Anti-DKK1 recombinant antibody, the EC50 is 1.283-2.544 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 28.5 kDa |
| Expression Region | 32-266aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human Dickkopf Related Protein 1 (DKK1) ELISA Kit [orb775961]
Human
0.16-10 ng/mL
0.058 ng/mL
96 T, 48 THuman Dickkopf Related Protein 1 (DKK1) ELISA Kit [orb1807572]
Human
31.25-2000pg/mL
13.7 pg/mL
48 T, 96 THuman DKK1 Protein, hFc Tag [orb1173930]
Unconjugated
The purity of the protein is greater than 90% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 51.9 kDa after removal of the signal peptide.The apparent molecular mass of DKK1-hFC is approximately 70 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μgBHQ880 Human Monoclonal Antibody [orb2977681]
ELISA, FA, FACS, In vivo
Human
Human
Monoclonal
Unconjugated
100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human DKK1 at 2 μg/mL can bind Anti-DKK1 recombinant antibody, the EC50 is 1.283-2.544 ng/mL.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human DKK1 Protein (orb1476706)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






