Availability
- Request Lead Time
- In stock and ready for quick dispatch
- Usually dispatched within 1 to 3 weeks
Shipping Destination:
United StatesShipping charges:
Freight/Packing: $34.00
Product Overview
| Product Name | Human CTAG1A protein |
|---|---|
| Catalog Number | orb245804 |
| Species/Host | Human |
| Conjugation | Unconjugated |
| Target | CTAG1A |
| Alternative Names | (click to expand) |
Product Properties
| Form/Appearance | Tris-based buffer, 50% glycerol |
|---|---|
| Storage | Store at -20°C. for extended storage, conserve at -20°C or -80°C. |
| Note | For research use only. |
| Protein Sequence | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR |
| Purity | >90% as determined by SDS-PAGE. |
| MW | 20 kDa |
| Source | Yeast |
| Uniprot ID | P78358 |
Product Description
Recombinant human Cancer/testis antigen 1
Application Notes
| Application Notes | This is His-tag protein |
|---|
Reviews
Write Your Own Review
