Human COL18A1 protein

SKU: orb603983

Description

This Human COL18A1 protein spans the amino acid sequence from region 1578-1754aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal GST-tagged
• Molecular Weight: 46.3 kDa
• Expression Region: 1578-1754aa
• Protein Length: Partial
• Protein Sequence: QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

Alpha 1 collagen type 18 (XVIII)(COL18A1), Alpha 1 type XVIII collagen, Antiangiogenic agent, COIA1_HUMAN, COL15A1, Col18a1, Collagen alpha 1(XV) chain, Collagen alpha 1(XVIII) chain, Collagen alpha-1(XV) chain, Collagen type XV proteoglycan, Collagen type XVIII alpha 1, Collagen XV, alpha 1 polypeptide, Collagen, type XV, alpha 1, Endostatin, Endostatin XV, FLJ27325, FLJ34914, FLJ38566, KNO, KNO1, KS, MGC74745, Multi functional protein MFP, OTTHUMP00000021782, OTTHUMP00000115472, OTTHUMP00000115473

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P39060