Human CLTA protein

SKU: orb54360

Description

This Human CLTA protein spans the amino acid sequence from region 1-218aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Neuroscience

Images & Validation

• Application Notes:
  N-terminal GST-tagged: N-terminal GST-tagged1-292AA: 1-218AAFull Length : Full Length of Isoform Non-brain

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal GST-tagged
• Expression Region: 1-218aa
• Protein Length: Full Length of Isoform Non-brain
• MW: 50.7 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Clathrin light chain A, Clathrin light chain B, Clathrin light chain LCA, Clathrin light chain LCB, Clathrin light polypeptide A, Clathrin light polypeptide, Clathrin light polypeptide B, Clathrin light polypeptide LCA, Clathrin light polypeptide LCB, Clathrin, light chain (Lcb), Clathrin, light polypeptide (Lca), Clathrin, light polypeptide (Lcb), CLCA_HUMAN, CLTA, CLTB, Lca, LCB

Quick Database Links

UniProt

P09496