Human CA5B protein

SKU: orb594918

Description

This Human CA5B protein spans the amino acid sequence from region 34-317aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Signal Transduction

Images & Validation

• Application Notes:
  Full Length of Mature Protein

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The esterase activity is determined to be 233 pmol/min/μg as measured under the described conditions.
• Tag: C-terminal 6xHis-tagged
• Molecular Weight: 33.77 kDa
• Expression Region: 34-317aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP
• Purity: Greater than 95% as determined by SDS-PAGE.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid
• Buffer/Preservatives: 0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.0
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Carbonic Anhydrase 5B Mitochondrial; Carbonate Dehydratase VB; Carbonic Anhydrase VB; CA-VB; CA5B

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

Q9Y2D0