You have no items in your shopping cart.
Cart summary
Human ALPI protein
Catalog Number: orb704893
| Catalog Number | orb704893 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Intestinal-type alkaline phosphatase(ALPI) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 58.4 kDa |
| UniProt ID | P09923 |
| Protein Sequence | VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Expression System | Expression Region: 20-503aa. Protein Length: Full Length of Mature Protein |
| Expression Region | 20-503aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | / Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
Human ALPI protein [orb245736]
Greater than 90% as determined by SDS-PAGE.
54.4 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgHuman ALPI protein [orb245527]
Greater than 90% as determined by SDS-PAGE.
55.5 kDa
E.coli
20 μg, 100 μg, 1 mgHuman ALPI Protein [orb1477845]
Greater than 95% as determined by SDS-PAGE.
55.2 kDa
Mammalian cell
1 mg, 20 μg, 100 μgHuman ALPP Protein, His Tag [orb1743334]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 53.5 kDa after removal of the signal peptide. The apparent molecular mass of ALPP-His is approximately 55-70 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μgRecombinant Human ALPP Protein, His Tag [orb1552938]
≥90% as determined by SDS-PAGE
This protein contains the human ALPP(Ile23-Asp506) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars