Cart summary

You have no items in your shopping cart.

HTR3E Rabbit Polyclonal Antibody (FITC)

HTR3E Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2090898

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2090898
CategoryAntibodies
DescriptionHTR3E Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityCanine, Human, Rabbit
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human HTR3E
Protein SequenceSynthetic peptide located within the following region: GPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFM
UniProt IDE9PGF1
MW53kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative names5-HT3E, 5-HT3-E, 5-HT3c1
NoteFor research use only
  • HTR3E Rabbit Polyclonal Antibody (FITC) [orb2133325]

    IF,  WB

    Canine, Equine, Human, Rabbit

    Rabbit

    Polyclonal

    FITC

    100 μl