Cart summary

You have no items in your shopping cart.

HTR3E Rabbit Polyclonal Antibody (HRP)

HTR3E Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2090897

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2090897
CategoryAntibodies
DescriptionHTR3E Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityCanine, Human, Rabbit
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human HTR3E
Protein SequenceSynthetic peptide located within the following region: GPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFM
UniProt IDE9PGF1
MW53kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative names5-HT3E, 5-HT3-E, 5-HT3c1
NoteFor research use only
  • HTR3E Rabbit Polyclonal Antibody (HRP) [orb2133324]

    IF,  WB

    Canine, Equine, Human, Rabbit

    Rabbit

    Polyclonal

    HRP

    100 μl