HSPA8 antibody

• Catalog Number: orb330555
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HSPA8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Equine, Goat, Mouse, Yeast, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 71kDa
• Target: HSPA8
• UniProt ID: P11142
• Protein Sequence: Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE
• NCBI: NP_006588
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HSC54 antibody, anti HSC70 antibody, anti HSC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Titer: 1:1000, Positive Control: Rat Brain Lysate.

Anti-HSPA8 / HSC70 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibodyconcentration 5 ug/ml.

Anti-HSPA8 / HSC70 antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Application: IHC, Species+tissue/cell type: Human brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.

WB Suggested Anti-HSPA8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: COLO205 cell lysate.