You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330554 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HSPA8 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Goat, Porcine, Sheep, Zebrafish |
Reactivity | Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 71kDa |
Target | HSPA8 |
UniProt ID | P11142 |
Protein Sequence | Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
NCBI | NP_006588 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HSC54 antibody, anti HSC70 antibody, anti HSC Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Mouse Brain Slices, Red: primary, Blue: DAPI, Primary, dilution: 1:400, Secondary Antibody: Anti-Rabbit IgG Alexa 594, Secondary, dilution: 1:400.
25 ug of the indicated Human whole cell tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Sample Type: 293T, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 0.5 ug/ml.
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: Human 293T cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. HSPA8 is strongly supported by BioGPS gene expression data to be expressed in MCF7.
Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. HSPA8 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
HSPA8 antibody - N-terminal region (orb330554) validated by WB using Rat Brain lysate at 1:1000.
Rabbit Anti-HSPA8 Antibody, Catalog Number: orb330554, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Nuclear in pinealocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-HSPA8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.
IHC, WB | |
Equine, Goat, Mouse, Yeast, Zebrafish | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC-Fr, IHC-P | |
Gallus, Porcine, Rabbit | |
Bovine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Equine, Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Equine, Hamster, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Equine, Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |