HSPA8 antibody

• Catalog Number: orb330554
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HSPA8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Goat, Porcine, Sheep, Zebrafish
• Reactivity: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 71kDa
• Target: HSPA8
• UniProt ID: P11142
• Protein Sequence: Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
• NCBI: NP_006588
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HSC54 antibody, anti HSC70 antibody, anti HSC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Mouse Brain Slices, Red: primary, Blue: DAPI, Primary, dilution: 1:400, Secondary Antibody: Anti-Rabbit IgG Alexa 594, Secondary, dilution: 1:400.

25 ug of the indicated Human whole cell tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 0.5 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human 293T cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. HSPA8 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. HSPA8 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

HSPA8 antibody - N-terminal region (orb330554) validated by WB using Rat Brain lysate at 1:1000.

Rabbit Anti-HSPA8 Antibody, Catalog Number: orb330554, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Nuclear in pinealocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-HSPA8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.