Cart summary

You have no items in your shopping cart.

HSPA8 Rabbit Polyclonal Antibody

Catalog Number: orb330554

DispatchUsually dispatched within 1 - 2 weeks
$ 600.00
Catalog Numberorb330554
CategoryAntibodies
DescriptionRabbit polyclonal antibody to HSPA8
TargetHSPA8
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman, Mouse, Rat
Predicted ReactivityBovine, Goat, Porcine, Sheep, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8
Protein SequenceSynthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
UniProt IDP11142
MW71kDa
Tested applicationsIHC, WB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesanti HSC54 antibody, anti HSC70 antibody, anti HSC
Read more...
NoteFor research use only
NCBINP_006588
HSPA8 Rabbit Polyclonal Antibody

Sample Type: Mouse Brain Slices, Red: primary, Blue: DAPI, Primary, dilution: 1:400, Secondary Antibody: Anti-Rabbit IgG Alexa 594, Secondary, dilution: 1:400.

HSPA8 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

HSPA8 Rabbit Polyclonal Antibody

Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

HSPA8 Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

HSPA8 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 0.5 ug/ml.

HSPA8 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

HSPA8 Rabbit Polyclonal Antibody

Sample Type: Human 293T cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

HSPA8 Rabbit Polyclonal Antibody

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. HSPA8 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

HSPA8 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. HSPA8 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

HSPA8 Rabbit Polyclonal Antibody

HSPA8 antibody - N-terminal region (orb330554) validated by WB using Rat Brain lysate at 1:1000.

HSPA8 Rabbit Polyclonal Antibody

Rabbit Anti-HSPA8 Antibody, Catalog Number: orb330554, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Nuclear in pinealocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

HSPA8 Rabbit Polyclonal Antibody

WB Suggested Anti-HSPA8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.

  • HSPA8 Rabbit Polyclonal Antibody [orb330555]

    IHC,  WB

    Equine, Goat, Mouse, Yeast, Zebrafish

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Hsc70 Rabbit Polyclonal Antibody [orb5486]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Gallus, Porcine, Rabbit

    Bovine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • HSPA8 Antibody (N-term) [orb1788284]

    FC,  IF,  IHC-P,  WB

    Equine, Hamster

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • HSPA8 Antibody (C-term) [orb1931376]

    FC,  IF,  IHC-P,  WB

    Equine, Hamster, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • HSPA8 Antibody (N-term) [orb1931377]

    FC,  IF,  IHC-P,  WB

    Equine, Hamster

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl