HSPA8 antibody

• Catalog Number: orb330554
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HSPA8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Goat, Human, Mouse, Porcine, Rat, Sheep, Zebrafish
• Reactivity: Goat, Human, Mouse, Porcine, Rat, Sheep, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 71kDa
• Target: HSPA8
• UniProt ID: P11142
• Protein Sequence: Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
• NCBI: NP_006588
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HSC54 antibody, anti HSC70 antibody, anti HSC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of 293T cell lysate tissue using HSPA8 antibody

Immunohistochemical staining of mouse brain tissue using HSPA8 antibody

Immunohistochemical staining of human Pineal tissue using HSPA8 antibody

Western blot analysis of rat Brain tissue using HSPA8 antibody

Western blot analysis of human 293T tissue using HSPA8 antibody