HSD3B2 Rabbit Polyclonal Antibody

• Catalog Number: orb579102
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HSD3B2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rat, Sheep
• Reactivity: Human, Monkey
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42kDa
• Target: HSD3B2
• UniProt ID: P26439
• Protein Sequence: Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN
• NCBI: NP_000189
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HSDB, HSD3B, SDR11E2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Monkey adrenal gland, Primary Antibody Dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: HSD3B2 Blue: Nucleus, Gene Name: HSD3B2.

Sample Type: Monkey vagina, Primary Antibody Dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: HSD3B2 Blue: Nucleus, Gene Name: HSD3B2.

WB Suggested Anti-HSD3B2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate.