HSD3B1 antibody

• Catalog Number: orb330204
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HSD3B1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Goat, Human, Monkey
• Reactivity: Equine, Goat, Human, Porcine, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42kDa
• Target: HSD3B1
• UniProt ID: P14060
• Protein Sequence: Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ
• NCBI: NP_000853
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HSD3B antibody, anti HSDB3 antibody, anti I a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Placenta tissue using HSD3B1 antibody

Western blot analysis of human Placenta tissue using HSD3B1 antibody

Western blot analysis of Monkey brain extract tissue using HSD3B1 antibody