HSD3B1 Rabbit Polyclonal Antibody

SKU: orb330204

Description

Rabbit polyclonal antibody to HSD3B1

Research Area

Metabolism Research

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Monkey
• Predicted Reactivity: Goat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B1
• Target: HSD3B1
• Protein Sequence: Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ
• Molecular Weight: 42kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti HSD3B antibody, anti HSDB3 antibody, anti I antibody, anti HSDB3A antibody, anti SDR11E1 antibody, anti 3BETAHSD antibody

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Lane 1: 50 ug monkey brain extract, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti rabbit-HRP, Secondary Antibody Dilution: 1:10000, Gene Name: HSD3B1.

WB Suggested Anti-HSD3B1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Placenta.

Quick Database Links

Gene Symbol

HSD3B1

UniProt

P14060

RefSeq (Protein):NP_000853