HPRT1 Rabbit Polyclonal Antibody

• Catalog Number: orb580413
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HPRT1
• Target: HPRT1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HPRT1
• Protein Sequence: Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK
• UniProt ID: P00492
• MW: 25 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HPRT, HGPRT
• Note: For research use only
• NCBI: NP_000185

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 0.5 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 0.5 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.

WB Suggested Anti-HPRT1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate. HPRT1 is supported by BioGPS gene expression data to be expressed in HeLa.