HOXB5 Rabbit Polyclonal Antibody

• Catalog Number: orb573802
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HOXB5
• Target: HOXB5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB5
• Protein Sequence: Synthetic peptide located within the following region: MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN
• UniProt ID: P09067
• MW: 30kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HOX2, HU-1, HOX2A, Hox2.1, HHO.C10
• Note: For research use only
• NCBI: NP_002138

Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml.

Human Pancrease lysate

WB Suggested Anti-HOXB5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.