HLX1 Rabbit Polyclonal Antibody

• Catalog Number: orb592899
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HLX1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Predicted Reactivity: Zebrafish
• Reactivity: Frog, Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HLX1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51kDa
• Target: HLX
• UniProt ID: Q14774
• Protein Sequence: Synthetic peptide located within the following region: PGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDR
• NCBI: NP_068777
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HB24, HLX1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml.

Sample Type: Xenopus Laevis embryo stage 46 gut tissue, Primary Dilution: 1:200.