HLA-F Rabbit Polyclonal Antibody

• Catalog Number: orb580721
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HLA-F
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Porcine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HLA-F
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48kDa
• Target: HLA-F
• UniProt ID: P30511
• Protein Sequence: Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT
• NCBI: NP_001091949
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HLAF, CDA12, HLA-5.4, HLA-CDA12
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-HLA-F Antibody, Catalog Number: orb580721, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Membrane and cytoplasmic in alveolar type I cells, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-HLA-F Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. HLA-F is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.