HLA-F Rabbit Polyclonal Antibody

• Catalog Number: orb580720
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HLA-F
• Target: HLA-F
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Porcine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HLA-F
• Protein Sequence: Synthetic peptide located within the following region: PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN
• UniProt ID: Q5JQI8
• MW: 48kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HLAF, CDA12, HLA-5.4, HLA-CDA12
• Note: For research use only
• NCBI: NP_001091949
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-HLA-F Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.