You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580720 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HLA-F |
Target | HLA-F |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Porcine |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HLA-F |
Protein Sequence | Synthetic peptide located within the following region: PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN |
UniProt ID | Q5JQI8 |
MW | 48kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | HLAF, CDA12, HLA-5.4, HLA-CDA12 |
Note | For research use only |
NCBI | NP_001091949 |
Expiration Date | 12 months from date of receipt. |
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-HLA-F Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
IHC, WB | |
Bovine, Porcine | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |