HLA-C Rabbit Polyclonal Antibody

• Catalog Number: orb585512
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HLA-C
• Target: HLA-C
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Porcine, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: PPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVET
• UniProt ID: Q29960
• MW: 38kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MHC, HLAC, HLC-C, D6S204, PSORS1, HLA-JY3
• Note: For research use only
• NCBI: NP_002108

WB Suggested Anti-HLA-C Antibody, Titration: 1.0 ug/ml, Positive Control: MDA-MB-435S Whole Cell.