You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576507 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HIF1A |
Target | HIF1A |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Gallus, Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HIF1A |
Protein Sequence | Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA |
UniProt ID | Q16665 |
MW | 93kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | HIF1, MOP1, PASD8, HIF-1A, bHLHe78, HIF-1alpha, HI Read more... |
Note | For research use only |
NCBI | NP_001521 |
25 ug of the indicated Mouse whole tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation.
HIF1A antibody - middle region (orb576507) validated by WB using chicken liver.
HIF1A antibody - middle region (orb576507) validated by WB using CoCl2 at 1:500.
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.
Lanes: Lane 1: 80 ug Chicken liver (nuclei), Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit IgG, Secondary Antibody Dilution: 1:2000, Gene Name: HIF1A.
WB Suggested Anti-HIF1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Small Intestine.
FC, WB | |
Gallus, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC | |
Gallus, Porcine | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |