HERC5 antibody

• Catalog Number: orb325063
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HERC5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Human, Porcine, Rabbit, Rat
• Reactivity: Equine, Human, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HERC5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 117kDa
• Target: HERC5
• UniProt ID: Q69G20
• Protein Sequence: Synthetic peptide located within the following region: FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL
• NCBI: NP_057407
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CEB1 antibody, anti CEBP1 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Pineal tissue using HERC5 antibody

Western blot analysis of human HEK293 tissue using HERC5 antibody

Western blot analysis of HepG2 cell lysate tissue using HERC5 antibody