HERC5 Rabbit Polyclonal Antibody

SKU: orb325063

Description

HERC5 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of HERC5. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human HERC5. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Protein Biochemistry

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HERC5
• Target: HERC5
• Protein Sequence: Synthetic peptide located within the following region: FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL
• Molecular Weight: 117kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CEB1 antibody, anti CEBP1 antibody

Quick Database Links

Gene Symbol

HERC5

UniProt

Q69G20

RefSeq (Protein):NP_057407