You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | ChIP, IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Guinea pig, Mouse, Sheep |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human HDAC9 |
| Target | HDAC9 |
| Protein Sequence | Synthetic peptide located within the following region: QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII |
| Molecular Weight | 65 kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Histone deacetylase 9 rabbit pAb Antibody [orb765397]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlHDAC9 Rabbit Polyclonal Antibody [orb500649]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Equine, Porcine, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The c-terminal peptide used to generate this antibody is not present in the full length canonical isoform, but is present in several HDAC9 isoforms below 654 amino acids. In these samples, isoform 8 of 65 kDa is recognized as well as possibly isoform 11 at 57 kDa.

Chromatin Immunoprecipitation (ChIP) Using HDAC9 antibody - C-terminal region (orb578600) and HCT116 Cells.

Sample Tissue: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Human kidney

Rabbit Anti-HDAC9 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-HDAC9 Antibody Titration: 1.25 ug/ml, Positive Control: A172 cell lysate. HDAC9 is supported by BioGPS gene expression data to be expressed in A172.
Documents Download
Request a Document
Protocol Information
HDAC9 Rabbit Polyclonal Antibody (orb578600)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


















