You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573966 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HCLS1 |
Target | HCLS1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1 |
Protein Sequence | Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP |
UniProt ID | P14317 |
MW | 54kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | HS1, p75, CTTNL, lckBP1 |
Note | For research use only |
NCBI | NP_005326 |
Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.
Rabbit Anti-HCLS1 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-HCLS1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-HCLS1 Antibody, Paraffin Embedded Tissue: Human Stomach, Cellular Data: Epithelial cells of Fundic Gland, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-HCLS1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, HCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat.
WB Suggested Anti-HCLS1 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate, HCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |