Queen's Awards Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HCLS1 Rabbit Polyclonal Antibody

SKU: orb573967

Description

Rabbit polyclonal antibody to HCLS1

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1
TargetHCLS1
Protein SequenceSynthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP
Molecular Weight54kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HS1, p75, CTTNL, lckBP1

Similar Products

  • HCLS1 Rabbit Polyclonal Antibody [orb573966]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • HAX1 Rabbit Polyclonal Antibody [orb1173490]

    ELISA,  FC,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • HCLS1 Antibody (C-term) [orb1936192]

    IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
  • HAX1 Rabbit Polyclonal Antibody [orb627615]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Lck BP-1 (phospho Tyr397) rabbit pAb Antibody [orb768598]

    IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HCLS1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

HCLS1 Rabbit Polyclonal Antibody

Rabbit Anti-HCLS1 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

HCLS1 Rabbit Polyclonal Antibody

Rabbit Anti-HCLS1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

HCLS1 Rabbit Polyclonal Antibody

Rabbit Anti-HCLS1 Antibody, Paraffin Embedded Tissue: Human Stomach, Cellular Data: Epithelial cells of Fundic Gland, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

HCLS1 Rabbit Polyclonal Antibody

WB Suggested Anti-HCLS1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat. HCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat.

HCLS1 Rabbit Polyclonal Antibody

WB Suggested Anti-HCLS1 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate, HCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005326

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

HCLS1 Rabbit Polyclonal Antibody (orb573967)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 530.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry