Cart summary

You have no items in your shopping cart.

HCK Rabbit Polyclonal Antibody

SKU: orb584947

Description

Rabbit polyclonal antibody to HCK

Research Area

Immunology & Inflammation, Protein Biochemistry

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human HCK
TargetHCK
Protein SequenceSynthetic peptide located within the following region: LVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIA
Molecular Weight55kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

JTK9, p59Hck, p61Hck

Similar Products

  • Phospho-Lyn (Tyr397) Rabbit Polyclonal Antibody [orb6340]

    IF,  IHC-Fr,  IHC-P,  WB

    Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-Lyn (Tyr507) Rabbit Polyclonal Antibody [orb106011]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Feline, Gallus, Guinea pig, Porcine, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • Hck (phospho Tyr410) rabbit pAb Antibody [orb768596]

    ELISA,  IF,  IHC

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Hck rabbit pAb Antibody [orb765372]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Lyn Rabbit Polyclonal Antibody [orb6338]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HCK Rabbit Polyclonal Antibody

Sample Tissue: Mouse Small Intestine, Antibody dilution: 1 ug/ml.

HCK Rabbit Polyclonal Antibody

WB Suggested Anti-HCK Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Thymus.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

HCK Rabbit Polyclonal Antibody (orb584947)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry