HBE1 Rabbit Polyclonal Antibody

• Catalog Number: orb588617
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HBE1
• Target: HBE1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen for Anti-HBE1 antibody is: synthetic peptide directed towards the N-terminal region of Human HBE
• Protein Sequence: Synthetic peptide located within the following region: AVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPK
• UniProt ID: P02100
• MW: 16 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HBE
• Note: For research use only
• NCBI: NP_005321.1

WB Suggested Anti-HBE antibody Titration: 1 ug/ml, Sample Type: Human Stomach Tumor.