You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582284 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Hbe1 |
Target | Hbe1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Rat |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hbe1 |
Protein Sequence | Synthetic peptide located within the following region: MVNFTAEEKSLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLS |
UniProt ID | O88752 |
MW | 16kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | Glnb1, Hbb-y |
Note | For research use only |
NCBI | NP_001008890 |
WB Suggested Anti-Hbe1 Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Stomach.
FC, IHC-P, WB | |
Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |