H2AFY Rabbit Polyclonal Antibody

• Catalog Number: orb583942
• Category: Antibodies
• Description: Rabbit polyclonal antibody to H2AFY
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human H2AFY
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41kDa
• Target: H2AFY
• UniProt ID: O75367
• Protein Sequence: Synthetic peptide located within the following region: MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA
• NCBI: NP_613075
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: H2A.y, H2A/y, H2AFY, mH2A1, H2AF12M, MACROH2A1.1,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-H2AFY Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: NCI-H226 cell lysate. H2AFY is strongly supported by BioGPS gene expression data to be expressed in NCI-H226.