GPX4 Rabbit Polyclonal Antibody

• Catalog Number: orb330978
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GPX4
• Target: GPX4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Goat, Guinea pig, Mouse, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPX4
• Protein Sequence: Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA
• UniProt ID: P36969
• MW: 19 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti MCSP antibody, anti PHGPx antibody, anti snGP
• Note: For research use only
• NCBI: NP_002076

25 ug of the indicated Human cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml. Recognizes 19 kDa cytoplasmic form in these cell lines, mitochondrial form of 22 kDa appears absent in these samples.

GPX4 antibody - middle region (orb330978) validated by WB using HepG2 cell lysate at 1.0 ug/ml. GPX4 is supported by BioGPS gene expression data to be expressed in HepG2.

Immunohistochemistry with formalin-fixed, paraffin-embedded human Heart tissue at an antibody concentration of 5.0 ug/ml using anti-GPX4 antibody (orb330978).

Immunohistochemistry with Rat Brain lysate tissue.