You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585275 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GPER |
Target | GPER1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Rat, Yeast |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: NVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYS |
UniProt ID | Q99527 |
MW | 42kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | mER, CEPR, GPER, DRY12, FEG-1, GPR30, LERGU, LyGPR Read more... |
Note | For research use only |
NCBI | NP_001496 |
WB Suggested Anti-GPER Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Kidney.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Canine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Canine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |