GPER Rabbit Polyclonal Antibody

• Catalog Number: orb585274
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GPER
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42kDa
• Target: GPER1
• UniProt ID: Q99527
• Protein Sequence: Synthetic peptide located within the following region: SFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSA
• NCBI: NP_001091671
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: mER, CEPR, GPER, DRY12, FEG-1, GPR30, LERGU, LyGPR
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. GPER1 is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-GPER Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.