Cart summary

You have no items in your shopping cart.

GLUD1 Rabbit Polyclonal Antibody

Catalog Number: orb579551

DispatchUsually dispatched within 3-7 working days
$ 600.00
Catalog Numberorb579551
CategoryAntibodies
DescriptionRabbit polyclonal antibody to GLUD1
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Sheep, Zebrafish
ReactivityHuman, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GLUD1
Concentration0.5 mg/ml
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ConjugationUnconjugated
MW61 kDa
TargetGLUD1
UniProt IDP00367
Protein SequenceSynthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER
NCBINP_005262
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative namesGDH, GDH1, GLUD
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.
GLUD1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

GLUD1 Rabbit Polyclonal Antibody

GLUD1 antibody - N-terminal region (orb579551) validated by WB using Fetal Liver Lysate at 1 ug/ml.

GLUD1 Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

GLUD1 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

GLUD1 Rabbit Polyclonal Antibody

Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

GLUD1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

GLUD1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

GLUD1 Rabbit Polyclonal Antibody

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. GLUD1 is supported by BioGPS gene expression data to be expressed in HEK293T.

GLUD1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

GLUD1 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

GLUD1 Rabbit Polyclonal Antibody

Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

GLUD1 Rabbit Polyclonal Antibody

Immunohistochemistry with cortex/kidney tissue.

GLUD1 Rabbit Polyclonal Antibody

Immunohistochemistry with pFa fixed human brain tissue.

GLUD1 Rabbit Polyclonal Antibody

Immunohistochemistry with pFA fixed human pancreas tissue tissue.

GLUD1 Rabbit Polyclonal Antibody

lanes 5: rat kidney cordex, lanes 6: rat kidney proximal tubules prepped from cortex, lanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysate, lanes 8: rat brain supernatant.

GLUD1 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

  • GLUD1 Rabbit Polyclonal Antibody [orb579550]

    IHC,  WB

    Bovine, Canine, Equine, Mouse, Porcine, Sheep, Yeast, Zebrafish

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Anti-GLUD1 Antibody [orb341324]

    IF,  IH,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
  • GLUD1 Antibody (C-term) [orb1938009]

    IHC-P,  WB

    Porcine, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Anti-GLURD1 Antibody [orb378088]

    IF,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
  • GRID1 Polyclonal Antibody [orb1420908]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P

    Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl