GLUD1 Rabbit Polyclonal Antibody

• Catalog Number: orb579550
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GLUD1
• Target: GLUD1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Sheep, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD1
• Protein Sequence: Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
• UniProt ID: P00367
• MW: 56kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GDH, GDH1, GLUD
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_005262
• Expiration Date: 12 months from date of receipt.

GLUD1 antibody - N-terminal region (orb579550) validated by WB using HT1080 cell lysate at 1 ug/ml. GLUD1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.

Immunohistochemistry with CORTEX/KIDNEY tissue.

Immunohistochemistry with PFA fixed human colon tissue tissue.

Immunohistochemistry with pFA fixed human pancreas tissue tissue.

lanes 5: rat kidney cordex, lanes 6: rat kidney proximal tubules prepped from cortex, lanes 7: LLCPK-F+ pig kidney proximal tubule tissue culture lysate, lanes 8: rat brain supernatant.