Glucagon-Like Peptide I (7-36), amide, human

SKU: orb2694622

Description

Human glucagon-like peptide I amide fragment 7-36 was used in DMEM (Dulbeccos) medium to culture 3T3-L1 adipocytes to study the relationship between adipose tissue GLP-1 receptors and obesity and insulin resistance. GLP-1 (glucagon-like peptide 1) (7-36) amide is a potent insulinotropic peptide that initiates glucose-induced insulin release after a meal or oral glucose. It has antidiabetic effects, so it may be used to treat non-insulin-dependent diabetes.

Images & Validation

−

Key Properties

−

Target	GCCR
Molecular Weight	3297.7
Protein Sequence	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Purity	≥95%

Storage & Handling

−

Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

GCCR

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols