(Glu8·9)-Helodermin

SKU: orb2692853

Description

(Glu⁸·⁹)-Helodermin has been isolated from the salivary gland of the Gila monster Heloderma suspectum. It consists of 35 amino acids and shares 53 and 42% homology with human pituitary adenylate cyclase activating polypeptide (PACAP) and vasoactive intestinal peptide (VIP), respectively. It was shown to have high affinity for the mammalian VIP₂ receptor and equal potency and efficacy for stimulating cAMP production compared with mammalian VIP and PACAP. Even a helodermin-preferring receptor has been described. Furthermore, immunohistochemical studies, using antibodies that did not cross-react with mammalian VIP or PACAP or other known members of the GLP-1 / VIP / PACAP peptide family suggested the existence of a mammalian homologue to (Glu⁸·⁹)-Helodermin distinct from VIP and PACAP.

Key Properties

• CAS Number: 209340-47-6
• MW: 3845.46
• Purity: ≥95%
• Formula: C₁₇₆H₂₈₃N₄₅O₅₁
• Protein Sequence: HSDAIFTEEYSKLLAKLALQKYLASILSRTSPPP-NH2

Storage & Handling

• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only