GLS Rabbit Polyclonal Antibody

• Catalog Number: orb582631
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GLS
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rabbit
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of human GLS
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 73kDa
• Target: GLS
• UniProt ID: O94925
• Protein Sequence: Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
• NCBI: NP_055720
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GAC, GAM, KGA, GLS1, AAD20, DEE71, GDPAG, CASGID,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

GLS antibody - C-terminal region (orb582631) validated by WB antibody dilution at 1:1000, Lane 5: rat kidney cortex, Lane 6: rat kidney proximal tubules, Lane 7: LLCPK1-F+ pig kidney proximal tubule tissue culture lysate, Lane 8: rat brain supernatant.

Sample Tissue: Human U937 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-GLS Antibody Titration: 0.2-1 ug/ml, Positive Control: ACHN cell lysate. GLS is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells.