You have no items in your shopping cart.
Description
Research Area
Metabolism Research
Images & Validation
−
Key Properties
−| CAS Number | 107444-51-9 |
|---|---|
| MW | 3297.7 Da |
| Purity | > 95% by HPLC |
| Formula | C149H226N40O45 |
| Protein Sequence | H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
Storage & Handling
−| Storage | Store dry, frozen and desiccated |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−, 107444-51-9, GLP-1 (7-36) amide, GLP-1 receptor, H-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, antiapoptotic , hormone, insulinotropic, proglucagon
Similar Products
−GLP-1 (7-36) Amide Human, Mouse Rat, Bovine, Guinea Pig peptide [orb216621]
> 95%
3297.7
Synthetic
5 mg, 1 mg, 10 mgTeneligliptin hydrobromide [orb1221666]
>98% (HPLC)
906093-29-6
628.86
C22H30N6OS·5/2BrH
10 mg, 25 mg, 50 mg, 200 mg, 100 mg, 500 mg, 1 g(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) [orb3054004]
>98% (HPLC)
215777-46-1
3313.7
C149H226N40O46
5 mg, 10 mg, 25 mg, 50 mg, 100 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide

