GLP-1 (7-36) amide (human, rat)

SKU: orb1147102

This product can be custom made

Description

Insulinotropic incretin peptide hormone; Peptides.

Research Area

Metabolism Research

Images & Validation

−

Key Properties

−

CAS Number	107444-51-9
MW	3297.7 Da
Purity	> 95% by HPLC
Formula	C₁₄₉H₂₂₆N₄₀O₄₅
Protein Sequence	H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Storage & Handling

−

Storage	Store dry, frozen and desiccated
Form/Appearance	Freeze dried solid
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

, 107444-51-9, GLP-1 (7-36) amide, GLP-1 receptor, H-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, antiapoptotic , hormone, insulinotropic, proglucagon

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols