You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573560 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GLIS2 |
Target | GLIS2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GLIS2 |
Protein Sequence | Synthetic peptide located within the following region: QDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNE |
UniProt ID | Q9BZE0 |
MW | 56 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | NKL, NPHP7 |
Note | For research use only |
NCBI | NP_115964 |
25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/ml.
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human Ovary Tumor, Antibody dilution: 1.0 ug/ml.
Positive control (+): Human Ovary Tumor (T-OV), Negative control (-): Human Liver Tumor (T-LI), Antibody concentration: 3 ug/ml.
Sample Type: Human Bile DuctPrimary, dilution: 1:500.
WB Suggested Anti-GLIS2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
WB | |
Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Gallus, Human, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Gallus, Human, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
BF750 |