You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573559 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GLIS2 |
Target | GLIS2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GLIS2 |
Protein Sequence | Synthetic peptide located within the following region: LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQF |
UniProt ID | Q9BZE0 |
MW | 56 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | NKL, NPHP7 |
Note | For research use only |
NCBI | NP_115964 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 7 ug/ml of the antibody was used in this experiment.
WB Suggested Anti-GLIS2 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Gallus, Human, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Gallus, Human, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
BF750 |