GJD2 Rabbit Polyclonal Antibody

SKU: orb329877

Description

GJD2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GJD2. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human GJD2. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GJD2
• Target: GJD2
• Protein Sequence: Synthetic peptide located within the following region: ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY
• Molecular Weight: 36 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CX36 antibody, anti GJA9 antibody, anti MGC138315 antibody, anti MGC138319 antibody

Quick Database Links

Gene Symbol

GJD2

UniProt

Q9UKL4

RefSeq (Protein):NP_065711