GJD2 Rabbit Polyclonal Antibody

SKU: orb329877

Description

Rabbit polyclonal antibody to GJD2

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GJD2
• Target: GJD2
• Protein Sequence: Synthetic peptide located within the following region: ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY
• Molecular Weight: 36 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CX36 antibody, anti GJA9 antibody, anti MGC138315 antibody, anti MGC138319 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

Sample Type: mouse brain, Dilution: dilution 1:2000.

WB Suggested Anti-GJD2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, GJD2 is supported by BioGPS gene expression data to be expressed in Jurkat.

Quick Database Links

Gene Symbol

GJD2

UniProt

Q9UKL4

RefSeq (Protein):NP_065711